Web Graph Explorer
aulapt.org
120 domains link to itIt links to 828in the Common Crawl web graph
Link graph of aulapt.org
- Links to it
- It links to
- Not explored yet
- Bigger = better connected
Click or press Enter on a domain to re-center the graph on it.
Domains linking to aulapt.org(top 40 of 120)
- google.com#3
- blogspot.com#40
- ning.com#2,050
- uchile.cl#3,926
- gva.es#4,185
- juntadeandalucia.es#4,717
- ugr.es#8,213
- jcyl.es#10,155
- caib.es#10,247
- castillalamancha.es#10,750
- xtec.cat#12,192
- intef.es#21,377
- magisnet.com#26,081
- educacionfpydeportes.gob.es#28,902
- catedu.es#28,904
- 4brain.ru#28,987
- didactalia.net#39,977
- educaciontrespuntocero.com#44,143
- psyciencia.com#50,082
- ciberespiral.org#71,825
- larioja.edu.es#85,044
- orientacionandujar.es#100,623
- webdelmaestrocmf.com#102,644
- elorienta.com#103,301
- ayudaparamaestros.com#117,433
- actiludis.com#121,725
- edufichas.com#140,340
- familiaycole.com#145,291
- actividadesdeinfantilyprimaria.com#163,898
- mate.tools#243,907
- disleo.com#298,594
- paperblog.com#393,318
- gndiario.com#559,205
- educrea.cl#619,905
- pictoeduca.com#709,051
- bretemas.gal#867,347
- sindicatopide.org#1,092,871
- campusfad.org#1,948,731
- spanishplayground.net#2,261,901
- madreshoy.com#2,266,624
Domains aulapt.org links to(top 40 of 828)
- facebook.com#1
- googleapis.com#2
- google.com#3
- instagram.com#4
- googletagmanager.com#5
- youtube.com#6
- gstatic.com#7
- twitter.com#8
- gravatar.com#12
- apple.com#13
- wikipedia.org#14
- pinterest.com#15
- youtu.be#17
- microsoft.com#19
- vimeo.com#23
- spotify.com#29
- wordpress.com#32
- amazonaws.com#36
- blogspot.com#40
- bit.ly#41
- dropbox.com#49
- creativecommons.org#51
- squarespace.com#55
- tumblr.com#57
- researchgate.net#58
- yahoo.com#59
- nytimes.com#62
- flickr.com#67
- fbcdn.net#68
- theguardian.com#69
- example.com#72
- openai.com#84
- sciencedirect.com#88
- bbc.co.uk#90
- wiley.com#112
- wp.com#117
- pixabay.com#119
- go.com#124
- googlesyndication.com#131
- cnet.com#141